SCOP 1.67: Domain d1dzyp_: 1dzy P:

Lineage for d1dzyp_ (1dzy P:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.74: AraD-like aldolase/epimerase [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD-like aldolase/epimerase [53639] (1 family)

5. Family c.74.1.1: AraD-like aldolase/epimerase [53640] (4 proteins)
   metal (zinc)-ion dependent

6. Protein L-fuculose-1-phosphate aldolase [53641] (1 species)
   class II aldolase

7. Species Escherichia coli [TaxId:562] [53642] (17 PDB entries)

8. Domain d1dzyp_: 1dzy P: [34982]
   complexed with bme, so4, zn; mutant

Details for d1dzyp_

PDB Entry: 1dzy, 2.44 Å

PDB Description: l-fuculose-1-phosphate aldolase from escherichia coli mutant e214a

SCOP Domain Sequences for d1dzyp_:

Sequence; same for both SEQRES and ATOM records:

>d1dzyp_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf

Timeline for d1dzyp_:

• d1dzyp_ first appeared (with stable ids) in SCOP 1.55
  
• d1dzyp_ appears in SCOP 1.65
  
• d1dzyp_ appears in SCOP 1.69
  
• d1dzyp_ appears in the current release, SCOPe 2.08