Lineage for d6bus1_ (6bus 1:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559568Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 2559569Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)
  6. 2559579Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 2559580Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (4 PDB entries)
  8. 2559582Domain d6bus1_: 6bus 1: [349819]
    automated match to d1dbda_

Details for d6bus1_

PDB Entry: 6bus (more details), 1.9 Å

PDB Description: extended e2 dna-binding domain of the bovine papillomavirus-1
PDB Compounds: (1:) Regulatory protein E2

SCOPe Domain Sequences for d6bus1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bus1_ d.58.8.1 (1:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}
hllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaerqgqaqili
tfgspsqrqdflkhvplppgmnisgftasldf

SCOPe Domain Coordinates for d6bus1_:

Click to download the PDB-style file with coordinates for d6bus1_.
(The format of our PDB-style files is described here.)

Timeline for d6bus1_: