SCOPe 2.08: Domain d6bf4l2: 6bf4 L:108-213

Lineage for d6bf4l2 (6bf4 L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6bf4l2: 6bf4 L:108-213 [349817]
   Other proteins in same PDB: d6bf4b_, d6bf4h_
   automated match to d3aazb2
   complexed with act, edo, nag

Details for d6bf4l2

PDB Entry: 6bf4, 2.38 Å

PDB Description: crystal structure of hiv-1 clade ae strain cne55 gp120 core in complex with neutralizing antibody vrc-pg05 that targets the center of the silent face on the outer domain of gp120

PDB Compounds: (L:) VRC-PG05 Fab light chain

SCOPe Domain Sequences for d6bf4l2:

Sequence; same for both SEQRES and ATOM records:

>d6bf4l2 b.1.1.0 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d6bf4l2:

• d6bf4l2 first appeared in SCOPe 2.07