Lineage for d6bf4l2 (6bf4 L:108-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (29 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 3049755Domain d6bf4l2: 6bf4 L:108-213 [349817]
    automated match to d3aazb2
    complexed with act, edo, man, nag

Details for d6bf4l2

PDB Entry: 6bf4 (more details), 2.38 Å

PDB Description: crystal structure of hiv-1 clade ae strain cne55 gp120 core in complex with neutralizing antibody vrc-pg05 that targets the center of the silent face on the outer domain of gp120
PDB Compounds: (L:) VRC-PG05 Fab light chain

SCOPe Domain Sequences for d6bf4l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bf4l2 b.1.1.0 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d6bf4l2:

Click to download the PDB-style file with coordinates for d6bf4l2.
(The format of our PDB-style files is described here.)

Timeline for d6bf4l2:

  • d6bf4l2 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6bf4l1