Lineage for d6bnld1 (6bnl D:2-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760447Domain d6bnld1: 6bnl D:2-118 [349799]
    Other proteins in same PDB: d6bnla1, d6bnlb_, d6bnlc2, d6bnle1, d6bnlf_, d6bnlg2
    automated match to d3q5ya1
    complexed with nag, qwv

Details for d6bnld1

PDB Entry: 6bnl (more details), 2.6 Å

PDB Description: crystal structure of tcr-mhc-like molecule
PDB Compounds: (D:) NKT Vbeta8.2 (MOUSE) - 2C12 TCR - hybrid mouse variable and human constant domains

SCOPe Domain Sequences for d6bnld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bnld1 b.1.1.0 (D:2-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d6bnld1:

Click to download the PDB-style file with coordinates for d6bnld1.
(The format of our PDB-style files is described here.)

Timeline for d6bnld1: