SCOPe 2.08: Domain d6bsxb1: 6bsx B:2-169

Lineage for d6bsxb1 (6bsx B:2-169)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein GTP-binding protein RheB [142275] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142276] (9 PDB entries)
   Uniprot Q15382 3-169

8. Domain d6bsxb1: 6bsx B:2-169 [349787]
   Other proteins in same PDB: d6bsxa2, d6bsxb2, d6bsxc2, d6bsxd2
   automated match to d3t5ga_
   complexed with act, e7s, edo, gdp, mg

Details for d6bsxb1

PDB Entry: 6bsx, 1.65 Å

PDB Description: crystal structure of rheb in complex with compound 1 at 1.65a resolution

PDB Compounds: (B:) GTP-binding protein Rheb

SCOPe Domain Sequences for d6bsxb1:

Sequence; same for both SEQRES and ATOM records:

>d6bsxb1 c.37.1.8 (B:2-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}
pqsksrkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdt
agqdeysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkk
dlhmervisyeegkalaeswnaaflessakenqtavdvfrriileaek

Timeline for d6bsxb1:

• d6bsxb1 first appeared in SCOPe 2.07