Lineage for d1dzwp_ (1dzw P:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74233Fold c.74: Class II aldolase [53638] (1 superfamily)
  4. 74234Superfamily c.74.1: Class II aldolase [53639] (1 family) (S)
  5. 74235Family c.74.1.1: Class II aldolase [53640] (1 protein)
  6. 74236Protein L-fuculose-1-phosphate aldolase [53641] (1 species)
  7. 74237Species Escherichia coli [TaxId:562] [53642] (17 PDB entries)
  8. 74247Domain d1dzwp_: 1dzw P: [34978]

Details for d1dzwp_

PDB Entry: 1dzw (more details), 2.17 Å

PDB Description: l-fuculose-1-phosphate aldolase from escherichia coli mutant f131a

SCOP Domain Sequences for d1dzwp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzwp_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatagtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf

SCOP Domain Coordinates for d1dzwp_:

Click to download the PDB-style file with coordinates for d1dzwp_.
(The format of our PDB-style files is described here.)

Timeline for d1dzwp_: