Lineage for d6bksb_ (6bks B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 3049710Domain d6bksb_: 6bks B: [349772]
    Other proteins in same PDB: d6bksa1, d6bksa2
    automated match to d1qfub_
    complexed with bma, man, nag, sia; mutant

Details for d6bksb_

PDB Entry: 6bks (more details), 1.8 Å

PDB Description: crystal structure of the a/wyoming/3/2003 (h3n2) influenza virus hemagglutinin d190e mutant in complex with 6'-sln
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6bksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bksb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfrhqnsegtgqaadlkstqaainqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
rtkkqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi

SCOPe Domain Coordinates for d6bksb_:

Click to download the PDB-style file with coordinates for d6bksb_.
(The format of our PDB-style files is described here.)

Timeline for d6bksb_:

  • d6bksb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07