SCOPe 2.06: Domain d2fuaa_: 2fua A:

Lineage for d2fuaa_ (2fua A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families)

5. Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
   metal (zinc)-ion dependent

6. Protein L-fuculose-1-phosphate aldolase [53641] (1 species)
   class II aldolase

7. Species Escherichia coli [TaxId:562] [53642] (17 PDB entries)

8. Domain d2fuaa_: 2fua A: [34977]
   complexed with bme, co, so4

Details for d2fuaa_

PDB Entry: 2fua, 2 Å

PDB Description: l-fuculose 1-phosphate aldolase crystal form t with cobalt

PDB Compounds: (A:) l-fuculose-1-phosphate aldolase

SCOPe Domain Sequences for d2fuaa_:

Sequence; same for both SEQRES and ATOM records:

>d2fuaa_ c.74.1.1 (A:) L-fuculose-1-phosphate aldolase {Escherichia coli [TaxId: 562]}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekfktyg

Timeline for d2fuaa_:

• d2fuaa_ first appeared (with stable ids) in SCOP 1.55, called d2fua__
  
• d2fuaa_ appears in SCOPe 2.05
  
• d2fuaa_ appears in SCOPe 2.07
  
• d2fuaa_ appears in the current release, SCOPe 2.08