Lineage for d2fua__ (2fua -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27171Fold c.74: Class II aldolase [53638] (1 superfamily)
  4. 27172Superfamily c.74.1: Class II aldolase [53639] (1 family) (S)
  5. 27173Family c.74.1.1: Class II aldolase [53640] (1 protein)
  6. 27174Protein L-fuculose-1-phosphate aldolase [53641] (1 species)
  7. 27175Species Escherichia coli [TaxId:562] [53642] (17 PDB entries)
  8. 27184Domain d2fua__: 2fua - [34977]

Details for d2fua__

PDB Entry: 2fua (more details), 2 Å

PDB Description: l-fuculose 1-phosphate aldolase crystal form t with cobalt

SCOP Domain Sequences for d2fua__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fua__ c.74.1.1 (-) L-fuculose-1-phosphate aldolase {Escherichia coli}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekfktyg

SCOP Domain Coordinates for d2fua__:

Click to download the PDB-style file with coordinates for d2fua__.
(The format of our PDB-style files is described here.)

Timeline for d2fua__: