Lineage for d2fua__ (2fua -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.74: Class II aldolase [53638] (1 superfamily) Superfamily c.74.1: Class II aldolase [53639] (1 family) 
Family c.74.1.1: Class II aldolase [53640] (1 protein) Protein L-fuculose-1-phosphate aldolase [53641] (1 species) Species Escherichia coli [TaxId:562] [53642] (17 PDB entries) 
Domain d2fua__: 2fua - [34977]
Details for d2fua__
PDB Entry: 2fua (more details), 2 Å
PDB Description: l-fuculose 1-phosphate aldolase crystal form t with cobalt
SCOP Domain Sequences for d2fua__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fua__ c.74.1.1 (-) L-fuculose-1-phosphate aldolase {Escherichia coli}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekfktyg
SCOP Domain Coordinates for d2fua__:
Click to download the PDB-style file with coordinates for d2fua__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fua__:
- d2fua__ appears in SCOP 1.57
- d2fua__ appears in the current release, SCOPe 2.08, called d2fuaa_
View in 3D