SCOPe 2.08: Domain d6bi0l2: 6bi0 L:108-213

Lineage for d6bi0l2 (6bi0 L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6bi0l2: 6bi0 L:108-213 [349767]
   Other proteins in same PDB: d6bi0h_, d6bi0i_
   automated match to d4jg1l2
   complexed with edo; mutant

Details for d6bi0l2

PDB Entry: 6bi0, 2.06 Å

PDB Description: trastuzumab fab n158a, d185a, k190a (light chain) triple mutant.

PDB Compounds: (L:) Trastuzumab anti-HER2 Fab Light Chain

SCOPe Domain Sequences for d6bi0l2:

Sequence; same for both SEQRES and ATOM records:

>d6bi0l2 b.1.1.0 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgasqesvteqd
skdstyslsstltlskaayekhavyacevthqglsspvtksfnrge

Timeline for d6bi0l2:

• d6bi0l2 first appeared in SCOPe 2.07