SCOP 1.59: Domain d1e47p_: 1e47 P:

Lineage for d1e47p_ (1e47 P:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.74: Class II aldolase [53638] (1 superfamily)

4. Superfamily c.74.1: Class II aldolase [53639] (1 family)

5. Family c.74.1.1: Class II aldolase [53640] (2 proteins)

6. Protein L-fuculose-1-phosphate aldolase [53641] (1 species)

7. Species Escherichia coli [TaxId:562] [53642] (17 PDB entries)

8. Domain d1e47p_: 1e47 P: [34976]

Details for d1e47p_

PDB Entry: 1e47, 2.15 Å

PDB Description: l-fuculose 1-phosphate aldolase from escherichia coli mutant e73q

SCOP Domain Sequences for d1e47p_:

Sequence; same for both SEQRES and ATOM records:

>d1e47p_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssqwrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf

Timeline for d1e47p_:

• d1e47p_ first appeared (with stable ids) in SCOP 1.55
  
• d1e47p_ appears in SCOP 1.57
  
• d1e47p_ appears in SCOP 1.61
  
• d1e47p_ appears in the current release, SCOPe 2.08