Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
Protein automated matches [190252] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries) |
Domain d6bmwa3: 6bmw A:219-525 [349756] Other proteins in same PDB: d6bmwa1, d6bmwa2, d6bmwb1, d6bmwb2 automated match to d2shpa1 complexed with 5od, dzs, gol, po4 |
PDB Entry: 6bmw (more details), 2.1 Å
SCOPe Domain Sequences for d6bmwa3:
Sequence, based on SEQRES records: (download)
>d6bmwa3 c.45.1.2 (A:219-525) automated matches {Human (Homo sapiens) [TaxId: 9606]} trinaaeiesrvrelsklaettdkvkqgfweefetlqqqeckllysrkegqrqenknknr yknilpfdhtrvvlhdgdpnepvsdyinaniimpefetkcnnskpkksyiatqgclqntv ndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaahdytl relklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagpvvvh csagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvqteaqyrfiymav qhyietl
>d6bmwa3 c.45.1.2 (A:219-525) automated matches {Human (Homo sapiens) [TaxId: 9606]} trinaaeiesrvrelsklqgfweefetlqqqeckllysrkegqrqenknknryknilpfd htrvvlhpvsdyinaniimpksyiatqgclqntvndfwrmvfqensrvivmttkevergk skcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhfrtwp dhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiirekgv dcdidvpktiqmvrsqrsgmvqteaqyrfiymavqhyietl
Timeline for d6bmwa3: