SCOPe 2.08: Domain d6bkoa1: 6bko A:11-325

Lineage for d6bkoa1 (6bko A:11-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza a virus [TaxId:430416] [349659] (4 PDB entries)

8. Domain d6bkoa1: 6bko A:11-325 [349747]
   Other proteins in same PDB: d6bkoa2, d6bkob_
   automated match to d5t0ba_
   complexed with nag; mutant

Details for d6bkoa1

PDB Entry: 6bko, 1.85 Å

PDB Description: crystal structure of the a/wyoming/3/2003 (h3n2) influenza virus hemagglutinin d190e mutant apo form

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6bkoa1:

Sequence; same for both SEQRES and ATOM records:

>d6bkoa1 b.19.1.0 (A:11-325) automated matches {Influenza a virus [TaxId: 430416]}
atlclghhavpngtivktitndqievtnatelvqssstggicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwagv
tqngtssackrrsnksffsrlnwlthlkykypalnvtmpnnekfdklyiwgvhhpvtdse
qislyaqasgritvstkrsqqtvipnigfrprvrdissrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpe

Timeline for d6bkoa1:

• d6bkoa1 first appeared in SCOPe 2.07