Lineage for d1e48p_ (1e48 P:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.74: Class II aldolase [53638] (1 superfamily) Superfamily c.74.1: Class II aldolase [53639] (1 family) 
Family c.74.1.1: Class II aldolase [53640] (1 protein) Protein L-fuculose-1-phosphate aldolase [53641] (1 species) Species Escherichia coli [TaxId:562] [53642] (17 PDB entries) 
Domain d1e48p_: 1e48 P: [34974]
Details for d1e48p_
PDB Entry: 1e48 (more details), 1.97 Å
PDB Description: l-fuculose 1-phosphate aldolase from escherichia coli mutant e73q/y113f/y209f
SCOP Domain Sequences for d1e48p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e48p_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssqwrfhmaayqsrpdanavvhnhavhctavsilnrsipaihfmiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf
SCOP Domain Coordinates for d1e48p_:
Click to download the PDB-style file with coordinates for d1e48p_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e48p_:
- d1e48p_ appears in SCOP 1.57
- d1e48p_ appears in the current release, SCOPe 2.08
View in 3D