SCOPe 2.08: Domain d6apcl1: 6apc L:2-108

Lineage for d6apcl1 (6apc L:2-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d6apcl1: 6apc L:2-108 [349732]
   Other proteins in same PDB: d6apcl2
   automated match to d1aqkl1
   complexed with so4

Details for d6apcl1

PDB Entry: 6apc, 1.7 Å

PDB Description: crystal structure of infant antibody adi-19425

PDB Compounds: (L:) IGL@ protein

SCOPe Domain Sequences for d6apcl1:

Sequence; same for both SEQRES and ATOM records:

>d6apcl1 b.1.1.1 (L:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsgapgqrvtisctgsssnigagydvhwyqqlpgtapklliygnsnrpsgvp
drfsgsksgtsaslaitglqaedeadyycqsydsslsgfyvfgtgtkvtvlg

Timeline for d6apcl1:

• d6apcl1 first appeared in SCOPe 2.07