Lineage for d6bkmc1 (6bkm C:11-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776430Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)
  8. 2776438Domain d6bkmc1: 6bkm C:11-325 [349711]
    Other proteins in same PDB: d6bkma2, d6bkmb_, d6bkmc2, d6bkmd_, d6bkme2, d6bkmf_
    automated match to d4xkga_
    complexed with nag, tam; mutant

Details for d6bkmc1

PDB Entry: 6bkm (more details), 2.2 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin e190d mutant apo form
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d6bkmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bkmc1 b.19.1.0 (C:11-325) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqd
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpe

SCOPe Domain Coordinates for d6bkmc1:

Click to download the PDB-style file with coordinates for d6bkmc1.
(The format of our PDB-style files is described here.)

Timeline for d6bkmc1: