Lineage for d1dzzp_ (1dzz P:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74233Fold c.74: Class II aldolase [53638] (1 superfamily)
  4. 74234Superfamily c.74.1: Class II aldolase [53639] (1 family) (S)
  5. 74235Family c.74.1.1: Class II aldolase [53640] (1 protein)
  6. 74236Protein L-fuculose-1-phosphate aldolase [53641] (1 species)
  7. 74237Species Escherichia coli [TaxId:562] [53642] (17 PDB entries)
  8. 74241Domain d1dzzp_: 1dzz P: [34971]

Details for d1dzzp_

PDB Entry: 1dzz (more details), 1.92 Å

PDB Description: l-fuculose-1-phosphate aldolase from escherichia coli mutant y113f

SCOP Domain Sequences for d1dzzp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzzp_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihfmiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekfkt

SCOP Domain Coordinates for d1dzzp_:

Click to download the PDB-style file with coordinates for d1dzzp_.
(The format of our PDB-style files is described here.)

Timeline for d1dzzp_: