Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [326193] (5 PDB entries) |
Domain d6bnib1: 6bni B:46-189 [349704] Other proteins in same PDB: d6bnia2, d6bnia3, d6bnib2, d6bnib3 automated match to d5elna1 protein/RNA complex; complexed with adn, edo, lys, na, so4 |
PDB Entry: 6bni (more details), 1.85 Å
SCOPe Domain Sequences for d6bnib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bnib1 b.40.4.0 (B:46-189) automated matches {Cryptosporidium parvum [TaxId: 353152]} hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr gelslfsksvvllspcyhmlptai
Timeline for d6bnib1: