| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
| Domain d6andl1: 6and L:1-106 [349700] Other proteins in same PDB: d6andl2 automated match to d1dn0a1 complexed with gol |
PDB Entry: 6and (more details), 1.75 Å
SCOPe Domain Sequences for d6andl1:
Sequence, based on SEQRES records: (download)
>d6andl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrssqsivhsvgntflewyqqkpgkapklliykvsnrf
sgvpsrfsgsgsgtdftltisslqpedfatyycfqgsqfpytfgqgtkvei
>d6andl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrssqsivflewyqqkpgkapklliykvsnrfsgvpsr
fsgsgsgtdftltisslqpedfatyycfqgsqfpytfgqgtkvei
Timeline for d6andl1: