Lineage for d6andl1 (6and L:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755055Domain d6andl1: 6and L:1-106 [349700]
    Other proteins in same PDB: d6andh_, d6andl2
    automated match to d1dn0a1
    complexed with gol

Details for d6andl1

PDB Entry: 6and (more details), 1.75 Å

PDB Description: pinatuzumab fab in complex with anti-kappa vhh domain
PDB Compounds: (L:) Pinatuzumab Fab light chain

SCOPe Domain Sequences for d6andl1:

Sequence, based on SEQRES records: (download)

>d6andl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrssqsivhsvgntflewyqqkpgkapklliykvsnrf
sgvpsrfsgsgsgtdftltisslqpedfatyycfqgsqfpytfgqgtkvei

Sequence, based on observed residues (ATOM records): (download)

>d6andl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrssqsivflewyqqkpgkapklliykvsnrfsgvpsr
fsgsgsgtdftltisslqpedfatyycfqgsqfpytfgqgtkvei

SCOPe Domain Coordinates for d6andl1:

Click to download the PDB-style file with coordinates for d6andl1.
(The format of our PDB-style files is described here.)

Timeline for d6andl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6andl2
View in 3D
Domains from other chains:
(mouse over for more information)
d6andh_