![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily) 3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5 |
![]() | Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) ![]() |
![]() | Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins) metal (zinc)-ion dependent |
![]() | Protein L-fuculose-1-phosphate aldolase [53641] (1 species) class II aldolase |
![]() | Species Escherichia coli [TaxId:562] [53642] (17 PDB entries) |
![]() | Domain d1e4bp_: 1e4b P: [34970] complexed with bme, so4, zn; mutant |
PDB Entry: 1e4b (more details), 1.84 Å
SCOPe Domain Sequences for d1e4bp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4bp_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli [TaxId: 562]} mernklarqiidtclemtrlglnqgtagqvsvryqdgmlitptgipyeklteshivfidg ngkheegklpssewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql ylttlaitdpvpvlsdeeiavvlekf
Timeline for d1e4bp_: