Lineage for d1e4cp_ (1e4c P:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.74: Class II aldolase [53638] (1 superfamily) Superfamily c.74.1: Class II aldolase [53639] (1 family) 
Family c.74.1.1: Class II aldolase [53640] (1 protein) Protein L-fuculose-1-phosphate aldolase [53641] (1 species) Species Escherichia coli [TaxId:562] [53642] (17 PDB entries) 
Domain d1e4cp_: 1e4c P: [34969]
Details for d1e4cp_
PDB Entry: 1e4c (more details), 1.66 Å
PDB Description: l-fuculose 1-phosphate aldolase from escherichia coli mutant s71q
SCOP Domain Sequences for d1e4cp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4cp_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli}
mernklarqiidtclemtrlglnqgtagnvsvryqdgmlitptgipyeklteshivfidg
ngkheegklpqsewrfhmaayqsrpdanavvhnhavhctavsilnrsipaihymiaaagg
nsipcapyatfgtrelsehvalalknrkatllqhhgliacevnlekalwlahevevlaql
ylttlaitdpvpvlsdeeiavvlekf
SCOP Domain Coordinates for d1e4cp_:
Click to download the PDB-style file with coordinates for d1e4cp_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e4cp_:
- d1e4cp_ appears in SCOP 1.57
- d1e4cp_ appears in the current release, SCOPe 2.08
View in 3D