Lineage for d1e19b_ (1e19 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27159Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
  4. 27160Superfamily c.73.1: Carbamate kinase-like [53633] (1 family) (S)
  5. 27161Family c.73.1.1: Carbamate kinase-like [53634] (1 protein)
  6. 27162Protein Carbamate kinase [53635] (2 species)
  7. 27168Species Pyrococcus furiosus [TaxId:186497] [53637] (1 PDB entry)
  8. 27170Domain d1e19b_: 1e19 B: [34968]

Details for d1e19b_

PDB Entry: 1e19 (more details), 1.5 Å

PDB Description: Structure of the carbamate kinase-like carbamoyl phosphate synthetase from the hyperthermophilic archaeon Pyrococcus furiosus bound to ADP

SCOP Domain Sequences for d1e19b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e19b_ c.73.1.1 (B:) Carbamate kinase {Pyrococcus furiosus}
gkrvvialggnalqqrgqkgsyeemmdnvrktarqiaeiiargyevvithgngpqvgsll
lhmdagqatygipaqpmdvagamsqgwigymiqqalknelrkrgmekkvvtiitqtivdk
ndpafqnptkpvgpfydeetakrlarekgwivkedsgrgwrrvvpspdpkghveaetikk
lvergviviasggggvpviledgeikgveavidkdlageklaeevnadifmiltdvngaa
lyygtekeqwlrevkveelrkyyeeghfkagsmgpkvlaairfiewggeraiiahlekav
ealegktgtqvlp

SCOP Domain Coordinates for d1e19b_:

Click to download the PDB-style file with coordinates for d1e19b_.
(The format of our PDB-style files is described here.)

Timeline for d1e19b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e19a_