SCOPe 2.08: Domain d1e19b_: 1e19 B:

Lineage for d1e19b_ (1e19 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.1: Carbamate kinase [53634] (1 protein)
   automatically mapped to Pfam PF00696

6. Protein Carbamate kinase [53635] (3 species)

7. Species Pyrococcus furiosus [TaxId:2261] [53637] (1 PDB entry)

8. Domain d1e19b_: 1e19 B: [34968]
   carbamate kinase-like carbamoyl phosphate synthetase
   complexed with adp, mg

Details for d1e19b_

PDB Entry: 1e19, 1.5 Å

PDB Description: Structure of the carbamate kinase-like carbamoyl phosphate synthetase from the hyperthermophilic archaeon Pyrococcus furiosus bound to ADP

PDB Compounds: (B:) carbamate kinase

SCOPe Domain Sequences for d1e19b_:

Sequence; same for both SEQRES and ATOM records:

>d1e19b_ c.73.1.1 (B:) Carbamate kinase {Pyrococcus furiosus [TaxId: 2261]}
gkrvvialggnalqqrgqkgsyeemmdnvrktarqiaeiiargyevvithgngpqvgsll
lhmdagqatygipaqpmdvagamsqgwigymiqqalknelrkrgmekkvvtiitqtivdk
ndpafqnptkpvgpfydeetakrlarekgwivkedsgrgwrrvvpspdpkghveaetikk
lvergviviasggggvpviledgeikgveavidkdlageklaeevnadifmiltdvngaa
lyygtekeqwlrevkveelrkyyeeghfkagsmgpkvlaairfiewggeraiiahlekav
ealegktgtqvlp

Timeline for d1e19b_:

• d1e19b_ first appeared (with stable ids) in SCOP 1.55
  
• d1e19b_ appears in SCOPe 2.07