SCOPe 2.08: Domain d6bkra1: 6bkr A:11-325

Lineage for d6bkra1 (6bkr A:11-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza a virus [TaxId:430416] [349659] (4 PDB entries)

8. Domain d6bkra1: 6bkr A:11-325 [349678]
   Other proteins in same PDB: d6bkra2, d6bkrb_
   automated match to d5t0ba_
   complexed with nag

Details for d6bkra1

PDB Entry: 6bkr, 1.76 Å

PDB Description: crystal structure of the a/wyoming/3/2003 (h3n2) influenza virus hemagglutinin in complex with 6'-sln

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6bkra1:

Sequence; same for both SEQRES and ATOM records:

>d6bkra1 b.19.1.0 (A:11-325) automated matches {Influenza a virus [TaxId: 430416]}
atlclghhavpngtivktitndqievtnatelvqssstggicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwagv
tqngtssackrrsnksffsrlnwlthlkykypalnvtmpnnekfdklyiwgvhhpvtdsd
qislyaqasgritvstkrsqqtvipnigfrprvrdissrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpe

Timeline for d6bkra1:

• d6bkra1 first appeared in SCOPe 2.07