Lineage for d6bksa1 (6bks A:11-325)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2370814Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2370815Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2371474Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2371475Protein automated matches [227017] (39 species)
    not a true protein
  7. 3049597Species Influenza a virus [TaxId:430416] [349659] (4 PDB entries)
  8. 3049598Domain d6bksa1: 6bks A:11-325 [349660]
    Other proteins in same PDB: d6bksa2, d6bksb_
    automated match to d5t0ba_
    complexed with bma, man, nag, sia; mutant

Details for d6bksa1

PDB Entry: 6bks (more details), 1.8 Å

PDB Description: crystal structure of the a/wyoming/3/2003 (h3n2) influenza virus hemagglutinin d190e mutant in complex with 6'-sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6bksa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bksa1 b.19.1.0 (A:11-325) automated matches {Influenza a virus [TaxId: 430416]}
atlclghhavpngtivktitndqievtnatelvqssstggicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwagv
tqngtssackrrsnksffsrlnwlthlkykypalnvtmpnnekfdklyiwgvhhpvtdse
qislyaqasgritvstkrsqqtvipnigfrprvrdissrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpryvk
qntlklatgmrnvpe

SCOPe Domain Coordinates for d6bksa1:

Click to download the PDB-style file with coordinates for d6bksa1.
(The format of our PDB-style files is described here.)

Timeline for d6bksa1:

  • d6bksa1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07

View in 3D
Domains from same chain:
(mouse over for more information)
d6bksa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6bksb_