Lineage for d6bkpb_ (6bkp B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 3049595Domain d6bkpb_: 6bkp B: [349657]
    Other proteins in same PDB: d6bkpa1, d6bkpa2
    automated match to d1qfub_
    complexed with bma, nag

Details for d6bkpb_

PDB Entry: 6bkp (more details), 2.05 Å

PDB Description: crystal structure of the a/michigan/15/2014 (h3n2) influenza virus hemagglutinin apo form
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6bkpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bkpb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhnvyrdealnnrfqi

SCOPe Domain Coordinates for d6bkpb_:

Click to download the PDB-style file with coordinates for d6bkpb_.
(The format of our PDB-style files is described here.)

Timeline for d6bkpb_:

  • d6bkpb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07