SCOPe 2.08: Domain d6bdzl2: 6bdz L:134-237

Lineage for d6bdzl2 (6bdz L:134-237)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6bdzl2: 6bdz L:134-237 [349649]
   Other proteins in same PDB: d6bdzh_, d6bdzl1
   automated match to d2fbjl2
   complexed with ca, so4, zn

Details for d6bdzl2

PDB Entry: 6bdz, 3.1 Å

PDB Description: adam10 extracellular domain bound by the 11g2 fab

PDB Compounds: (L:) 11G2 Fab Light Chain

SCOPe Domain Sequences for d6bdzl2:

Sequence; same for both SEQRES and ATOM records:

>d6bdzl2 b.1.1.2 (L:134-237) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d6bdzl2:

• d6bdzl2 first appeared in SCOPe 2.07