Lineage for d6bkmb_ (6bkm B:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591649Species Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId:384505] [327816] (3 PDB entries)
  8. 3049583Domain d6bkmb_: 6bkm B: [349645]
    Other proteins in same PDB: d6bkma1, d6bkma2, d6bkmc1, d6bkmc2, d6bkme1, d6bkme2
    automated match to d1qfub_
    complexed with bma, man, nag, tam; mutant

Details for d6bkmb_

PDB Entry: 6bkm (more details), 2.2 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin e190d mutant apo form
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6bkmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bkmb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId: 384505]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d6bkmb_:

Click to download the PDB-style file with coordinates for d6bkmb_.
(The format of our PDB-style files is described here.)

Timeline for d6bkmb_:

  • d6bkmb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07