SCOPe 2.07: Domain d6bkpa1: 6bkp A:11-325

Lineage for d6bkpa1 (6bkp A:11-325)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza a virus [TaxId:1731408] [349638] (2 PDB entries)

8. Domain d6bkpa1: 6bkp A:11-325 [349639]
   Other proteins in same PDB: d6bkpa2, d6bkpb_
   automated match to d5t0ba_
   complexed with bma, nag

Details for d6bkpa1

PDB Entry: 6bkp, 2.05 Å

PDB Description: crystal structure of the a/michigan/15/2014 (h3n2) influenza virus hemagglutinin apo form

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6bkpa1:

Sequence; same for both SEQRES and ATOM records:

>d6bkpa1 b.19.1.0 (A:11-325) automated matches {Influenza a virus [TaxId: 1731408]}
atlclghhavpngtivktitndrievtnatelvqnssigeicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrssssffsrlnwlthlnykypalnvtmpnneqfdklyiwgvhhpgtdkd
qiflyaqssgritvstkrsqqavipnigsrpkirdipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcksecitpngsipndkpfqnvnritygacpryvk
hstlklatgmrnvpe

Timeline for d6bkpa1:

• d6bkpa1 is new in SCOPe 2.07-stable
  
• d6bkpa1 appears in the current release, SCOPe 2.08