Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza a virus [TaxId:1731408] [349638] (2 PDB entries) |
Domain d6bkpa1: 6bkp A:11-325 [349639] Other proteins in same PDB: d6bkpa2, d6bkpb_ automated match to d5t0ba_ complexed with bma, nag |
PDB Entry: 6bkp (more details), 2.05 Å
SCOPe Domain Sequences for d6bkpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bkpa1 b.19.1.0 (A:11-325) automated matches {Influenza a virus [TaxId: 1731408]} atlclghhavpngtivktitndrievtnatelvqnssigeicdsphqildgenctlidal lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv tqngtssacirrssssffsrlnwlthlnykypalnvtmpnneqfdklyiwgvhhpgtdkd qiflyaqssgritvstkrsqqavipnigsrpkirdipsrisiywtivkpgdillinstgn liaprgyfkirsgkssimrsdapigkcksecitpngsipndkpfqnvnritygacpryvk hstlklatgmrnvpe
Timeline for d6bkpa1: