Lineage for d6bkpa1 (6bkp A:11-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776617Species Influenza a virus [TaxId:1731408] [349638] (2 PDB entries)
  8. 2776619Domain d6bkpa1: 6bkp A:11-325 [349639]
    Other proteins in same PDB: d6bkpa2, d6bkpb_
    automated match to d5t0ba_
    complexed with nag

Details for d6bkpa1

PDB Entry: 6bkp (more details), 2.05 Å

PDB Description: crystal structure of the a/michigan/15/2014 (h3n2) influenza virus hemagglutinin apo form
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6bkpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bkpa1 b.19.1.0 (A:11-325) automated matches {Influenza a virus [TaxId: 1731408]}
atlclghhavpngtivktitndrievtnatelvqnssigeicdsphqildgenctlidal
lgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwtgv
tqngtssacirrssssffsrlnwlthlnykypalnvtmpnneqfdklyiwgvhhpgtdkd
qiflyaqssgritvstkrsqqavipnigsrpkirdipsrisiywtivkpgdillinstgn
liaprgyfkirsgkssimrsdapigkcksecitpngsipndkpfqnvnritygacpryvk
hstlklatgmrnvpe

SCOPe Domain Coordinates for d6bkpa1:

Click to download the PDB-style file with coordinates for d6bkpa1.
(The format of our PDB-style files is described here.)

Timeline for d6bkpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bkpa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6bkpb_