| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d6bhqb2: 6bhq B:340-444 [349627] automated match to d1hzhh4 complexed with gol |
PDB Entry: 6bhq (more details), 2.05 Å
SCOPe Domain Sequences for d6bhqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bhqb2 b.1.1.0 (B:340-444) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgpvrapqvyvlpppaeemtkkefsltcmitgflpaeiavdwtsngrteqnykntatvld
sdgsyfmysklrvqkstwergslfacsvvheglhnhlttktisrs
Timeline for d6bhqb2: