Lineage for d6bhqb1 (6bhq B:238-339)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370338Domain d6bhqb1: 6bhq B:238-339 [349626]
    automated match to d1hzhh3
    complexed with bma, ful, gal, gol, man, nag

Details for d6bhqb1

PDB Entry: 6bhq (more details), 2.05 Å

PDB Description: mouse immunoglobulin g 2c fc fragment with complex-type glycan
PDB Compounds: (B:) Igh protein

SCOPe Domain Sequences for d6bhqb1:

Sequence, based on SEQRES records: (download)

>d6bhqb1 b.1.1.0 (B:238-339) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
psvfifppkikdvlmislspmvtcvvvdvseddpdvqiswfvnnvevhtaqtqthredyn
stlrvvsalpiqhqdwmsgkefkckvnnralpspiektiskp

Sequence, based on observed residues (ATOM records): (download)

>d6bhqb1 b.1.1.0 (B:238-339) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
psvfifppkikdvlmislspmvtcvvvdeddpdvqiswfvnnvevhtaqtqthredylrv
vsalpiqhqdwmsgkefkckvnnpspiektiskp

SCOPe Domain Coordinates for d6bhqb1:

Click to download the PDB-style file with coordinates for d6bhqb1.
(The format of our PDB-style files is described here.)

Timeline for d6bhqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bhqb2