Lineage for d1fgs_2 (1fgs 1-296)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.72: Ribokinase-like [53612] (3 superfamilies)
core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
potential superfamily: members of this fold have similar functions but different ATP-binding sites
Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) 
has extra strand located between strands 1 and 2
Family c.72.2.2: Folylpolyglutamate synthetase [53629] (1 protein) Protein Folylpolyglutamate synthetase [53630] (2 species) Species Lactobacillus casei [TaxId:1582] [53631] (3 PDB entries) 
Domain d1fgs_2: 1fgs 1-296 [34962]
Other proteins in same PDB: d1fgs_1
complexed with mg, pop
Details for d1fgs_2
PDB Entry: 1fgs (more details), 2.4 Å
PDB Description: folylpolyglutamate synthetase from lactobacillus casei
SCOP Domain Sequences for d1fgs_2:
Sequence, based on SEQRES records: (download)
>d1fgs_2 c.72.2.2 (1-296) Folylpolyglutamate synthetase {Lactobacillus casei}
mnytetvayihsfprlaktgdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahv
leasgltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvte
fefitalaywyfrqrqvdvavievgiggdtdstnvitpvvsvltevaldhqkllghtita
iakhkagiikrgipvvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrf
tyedqdgrisdlevplvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaash
Sequence, based on observed residues (ATOM records): (download)
>d1fgs_2 c.72.2.2 (1-296) Folylpolyglutamate synthetase {Lactobacillus casei}
mnytetvayihsfprlagdhrriltllhalgnpqqqgryihvtgtngkgsaanaiahvle
asgltvglytspfimrfnerimidhepipdaalvnavafvraalerlqqqqadfnvtefe
fitalaywyfrqrqvdvavievgdstnvitpvvsvltevaldtitaiakhkagiikrgip
vvtgnlvpdaaavvaakvattgsqwlrfdrdfsvpkaklhgwgqrftyedqdgrisdlev
plvgdyqqrnmaiaiqtakvyakqtewpltpqnirqglaash
SCOP Domain Coordinates for d1fgs_2:
Click to download the PDB-style file with coordinates for d1fgs_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fgs_2:
- d1fgs_2 first appeared (with stable ids) in SCOP 1.55
- d1fgs_2 appears in SCOP 1.69
- d1fgs_2 is called d1fgsa2 in SCOP 1.73
- d1fgs_2 appears in the current release, SCOPe 2.08, called d1fgsa2
View in 3D
