Lineage for d6bhqa2 (6bhq A:340-443)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759858Domain d6bhqa2: 6bhq A:340-443 [349616]
    automated match to d1hzhh4
    complexed with gol

Details for d6bhqa2

PDB Entry: 6bhq (more details), 2.05 Å

PDB Description: mouse immunoglobulin g 2c fc fragment with complex-type glycan
PDB Compounds: (A:) Igh protein

SCOPe Domain Sequences for d6bhqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bhqa2 b.1.1.0 (A:340-443) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rgpvrapqvyvlpppaeemtkkefsltcmitgflpaeiavdwtsngrteqnykntatvld
sdgsyfmysklrvqkstwergslfacsvvheglhnhlttktisr

SCOPe Domain Coordinates for d6bhqa2:

Click to download the PDB-style file with coordinates for d6bhqa2.
(The format of our PDB-style files is described here.)

Timeline for d6bhqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bhqa1