Lineage for d6bf4c1 (6bf4 C:1-107)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. Protein automated matches [190740] (30 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1747 PDB entries)
  8. Domain d6bf4c1: 6bf4 C:1-107 [349608]
    Other proteins in same PDB: d6bf4b_, d6bf4h_
    automated match to d3aazb1
    complexed with act, edo, nag

Details for d6bf4c1

PDB Entry: 6bf4 (more details), 2.38 Å

PDB Description: crystal structure of hiv-1 clade ae strain cne55 gp120 core in complex with neutralizing antibody vrc-pg05 that targets the center of the silent face on the outer domain of gp120
PDB Compounds: (C:) VRC-PG05 Fab light chain

SCOPe Domain Sequences for d6bf4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bf4c1 b.1.1.0 (C:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratihckssqsvlyrpnnrnyvawyqqkpgqpprllihwasfr
esgvpdrftgsgsgtdftltisslqaedvavyycqqyfflysfgggtklein

SCOPe Domain Coordinates for d6bf4c1 are not available.

Timeline for d6bf4c1:

Domains from same chain:
(mouse over for more information)
d6bf4c2
Domains from other chains:
(mouse over for more information)
d6bf4b_, d6bf4h_, d6bf4l1, d6bf4l2