![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily) multihelical; bundle, contains interrupted helices |
![]() | Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) ![]() contains heme-dependent enzymes |
![]() | Family a.266.1.2: Indoleamine 2,3-dioxygenase-like [140963] (3 proteins) Pfam PF01231; contains extra N-terminal all-alpha subdomain of similar fold to the GST C-terminal domain (47615) |
![]() | Protein automated matches [190585] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187592] (52 PDB entries) |
![]() | Domain d6azva_: 6azv A: [349570] Other proteins in same PDB: d6azvc2 automated match to d4u72b_ complexed with c4v |
PDB Entry: 6azv (more details), 2.76 Å
SCOPe Domain Sequences for d6azva_:
Sequence, based on SEQRES records: (download)
>d6azva_ a.266.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadc vlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamq mqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvy egfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcs lesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktse dpskleakgtggtdlmnflktvrstteksllk
>d6azva_ a.266.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadc vlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamq mqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvy egfwedpkefaggsagqssvfqcfdvllgiqqgghaaqflqdmrrymppahrnflcsles npsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqdlmnflktvrst teksllk
Timeline for d6azva_:
![]() Domains from other chains: (mouse over for more information) d6azvb_, d6azvc1, d6azvc2, d6azvd_ |