Lineage for d1uaga3 (1uag A:94-297)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137975Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) (S)
    has extra strand located between strands 1 and 2
  5. 2137976Family c.72.2.1: MurCDEF [53624] (5 protein domains)
    automatically mapped to Pfam PF08245
  6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53625] (1 species)
  7. Species Escherichia coli [TaxId:562] [53626] (7 PDB entries)
  8. 2137998Domain d1uaga3: 1uag A:94-297 [34957]
    Other proteins in same PDB: d1uaga1, d1uaga2
    complexed with so4, uma

Details for d1uaga3

PDB Entry: 1uag (more details), 1.95 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) udp-n-acetylmuramoyl-l-alanine/:d-glutamate ligase

SCOPe Domain Sequences for d1uaga3:

Sequence, based on SEQRES records: (download)

>d1uaga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Sequence, based on observed residues (ATOM records): (download)

>d1uaga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpircvsfgvnmgdyhlnetwlrvkgekvlnvkemklsgqhnytnalaalaladaa
glprasslkalttft

SCOPe Domain Coordinates for d1uaga3:

Click to download the PDB-style file with coordinates for d1uaga3.
(The format of our PDB-style files is described here.)

Timeline for d1uaga3: