Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Hypoxanthine PRTase [53286] (4 species) |
Species Trypanosoma brucei [TaxId:5702] [324926] (10 PDB entries) |
Domain d6apua_: 6apu A: [349567] automated match to d1p17b_ complexed with 3l6, mg, peg, so4 |
PDB Entry: 6apu (more details), 1.84 Å
SCOPe Domain Sequences for d6apua_:
Sequence, based on SEQRES records: (download)
>d6apua_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]} ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv rilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtaltlre vvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdv vilkpsvyetwgkel
>d6apua_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]} ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv rilgdfgvptrveflrassydirgkhvlvledildtaltlrevvdslkksepasiktlva idkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkel
Timeline for d6apua_: