Lineage for d6apua_ (6apu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891394Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2891405Species Trypanosoma brucei [TaxId:5702] [324926] (10 PDB entries)
  8. 2891412Domain d6apua_: 6apu A: [349567]
    automated match to d1p17b_
    complexed with 3l6, mg, peg, so4

Details for d6apua_

PDB Entry: 6apu (more details), 1.84 Å

PDB Description: crystal structure of trypanosoma brucei hypoxanthine-guanine phosphoribosyltranferase in complex with (2-{[2-(2-amino-6-oxo-1,6- dihydro-9h-purin-9-yl)ethyl](3-aminopropyl)amino}ethyl)phosphonic acid
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d6apua_:

Sequence, based on SEQRES records: (download)

>d6apua_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtaltlre
vvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdv
vilkpsvyetwgkel

Sequence, based on observed residues (ATOM records): (download)

>d6apua_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflrassydirgkhvlvledildtaltlrevvdslkksepasiktlva
idkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkel

SCOPe Domain Coordinates for d6apua_:

Click to download the PDB-style file with coordinates for d6apua_.
(The format of our PDB-style files is described here.)

Timeline for d6apua_: