Lineage for d5w08r2 (5w08 R:110-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750931Domain d5w08r2: 5w08 R:110-212 [349563]
    Other proteins in same PDB: d5w08a_, d5w08b_, d5w08c_, d5w08d_, d5w08e_, d5w08f_, d5w08g_, d5w08h1, d5w08i_, d5w08j1, d5w08k_, d5w08l1, d5w08m_, d5w08n1, d5w08o_, d5w08p1, d5w08q_, d5w08r1
    automated match to d1mcol2
    complexed with gol, nag

Details for d5w08r2

PDB Entry: 5w08 (more details), 2.6 Å

PDB Description: a/texas/50/2012(h3n2) influenza hemagglutinin in complex with k03.12 fab
PDB Compounds: (R:) K03.12 antibody light chain

SCOPe Domain Sequences for d5w08r2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w08r2 b.1.1.2 (R:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d5w08r2:

Click to download the PDB-style file with coordinates for d5w08r2.
(The format of our PDB-style files is described here.)

Timeline for d5w08r2: