Lineage for d2uaga3 (2uag A:94-297)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27104Fold c.72: Ribokinase-like [53612] (2 superfamilies)
  4. 27141Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (2 families) (S)
  5. 27142Family c.72.2.1: MurD/MurF [53624] (2 proteins)
  6. 27147Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase, gene MurD [53625] (1 species)
  7. 27148Species Escherichia coli [TaxId:562] [53626] (6 PDB entries)
  8. 27149Domain d2uaga3: 2uag A:94-297 [34954]
    Other proteins in same PDB: d2uaga1, d2uaga2

Details for d2uaga3

PDB Entry: 2uag (more details), 1.7 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d2uaga3:

Sequence, based on SEQRES records: (download)

>d2uaga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase, gene MurD {Escherichia coli}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Sequence, based on observed residues (ATOM records): (download)

>d2uaga3 c.72.2.1 (A:94-297) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase, gene MurD {Escherichia coli}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpercvsfgvnmgdyhlnhetwlrvkgekvlnvkemklsgqhnytnalaalalada
aglprasslkalttft

SCOP Domain Coordinates for d2uaga3:

Click to download the PDB-style file with coordinates for d2uaga3.
(The format of our PDB-style files is described here.)

Timeline for d2uaga3: