Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Phosphopantetheine adenylyltransferase [52398] (7 species) |
Species Escherichia coli [TaxId:83333] [350064] (18 PDB entries) |
Domain d6b7ab1: 6b7a B:2-159 [349530] Other proteins in same PDB: d6b7aa2, d6b7ab2 automated match to d1gn8a_ complexed with cl, cwm, peg, pop, so4 |
PDB Entry: 6b7a (more details), 1.99 Å
SCOPe Domain Sequences for d6b7ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b7ab1 c.26.1.3 (B:2-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]} qkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatah lgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmps kewsfissslvkevarhqgdvthflpenvhqalmakla
Timeline for d6b7ab1: