Lineage for d1esqb1 (1esq B:1-271)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27104Fold c.72: Ribokinase-like [53612] (2 superfamilies)
  4. 27105Superfamily c.72.1: Ribokinase-like [53613] (2 families) (S)
  5. 27125Family c.72.1.2: Hydroxyethylthiazole kinase (thz kinase) [53620] (1 protein)
  6. 27126Protein Hydroxyethylthiazole kinase (thz kinase) [53621] (1 species)
  7. 27127Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries)
  8. 27139Domain d1esqb1: 1esq B:1-271 [34952]

Details for d1esqb1

PDB Entry: 1esq (more details), 2.5 Å

PDB Description: crystal structure of thiazole kinase mutant (c198s) with atp and thiazole phosphate.

SCOP Domain Sequences for d1esqb1:

Sequence, based on SEQRES records: (download)

>d1esqb1 c.72.1.2 (B:1-271) Hydroxyethylthiazole kinase (thz kinase) {Bacillus subtilis}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
ytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
pgsfqiellnklstvteqdvqewatiervtv

Sequence, based on observed residues (ATOM records): (download)

>d1esqb1 c.72.1.2 (B:1-271) Hydroxyethylthiazole kinase (thz kinase) {Bacillus subtilis}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdiirlaqqaaqklntviaitgevdviadtshvytlhnghklltkvt
gagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkgpgsfqiellnklst
vteqdvqewatiervtv

SCOP Domain Coordinates for d1esqb1:

Click to download the PDB-style file with coordinates for d1esqb1.
(The format of our PDB-style files is described here.)

Timeline for d1esqb1: