Lineage for d5yuaa1 (5yua A:1001-1226)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023737Family f.14.1.2: Voltage-gated Na/Ca cation channels [310631] (4 proteins)
    Pfam PF08016
  6. 3023784Protein automated matches [332795] (1 species)
    not a true protein
  7. 3023785Species Arcobacter butzleri [TaxId:28197] [332796] (2 PDB entries)
  8. 3023786Domain d5yuaa1: 5yua A:1001-1226 [349518]
    Other proteins in same PDB: d5yuaa2
    automated match to d3rvya_
    complexed with 1n7, ca, lmt, px4

Details for d5yuaa1

PDB Entry: 5yua (more details), 2.8 Å

PDB Description: crystal structure of voltage-gated sodium channel navab in high-ph condition
PDB Compounds: (A:) Ion transport protein

SCOPe Domain Sequences for d5yuaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yuaa1 f.14.1.2 (A:1001-1226) automated matches {Arcobacter butzleri [TaxId: 28197]}
mylritnivessfftkfiiylivlngitmgletsktfmqsfgvyttlfnqivitiftiei
ilriyvhrisffkdpwslfdffvvaislvptssgfeilrvlrvlrlfrlvtavpqmrkiv
salisvipgmlsvialmtlffyifaimatqlfgerfpewfgtlgesfytlfqvmtlesws
mgivrplmevypyawvffipfifvvtfvminlvvaiivdamailnq

SCOPe Domain Coordinates for d5yuaa1:

Click to download the PDB-style file with coordinates for d5yuaa1.
(The format of our PDB-style files is described here.)

Timeline for d5yuaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5yuaa2