Lineage for d5ypid_ (5ypi D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2997639Species Escherichia coli [TaxId:562] [226145] (21 PDB entries)
  8. 2997689Domain d5ypid_: 5ypi D: [349514]
    automated match to d4eyba_
    complexed with 8yf, cl, gol, so4, zn

Details for d5ypid_

PDB Entry: 5ypi (more details), 2.3 Å

PDB Description: crystal structure of ndm-1 bound to hydrolyzed imipenem representing an ei1 complex
PDB Compounds: (D:) Metallo-beta-lactamase NDM-1

SCOPe Domain Sequences for d5ypid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ypid_ d.157.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]}
dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnlg
dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5ypid_:

Click to download the PDB-style file with coordinates for d5ypid_.
(The format of our PDB-style files is described here.)

Timeline for d5ypid_: