| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries) |
| Domain d6at6b2: 6at6 B:120-246 [349509] Other proteins in same PDB: d6at6a1, d6at6a2, d6at6b1 automated match to d3of6b2 |
PDB Entry: 6at6 (more details), 1.42 Å
SCOPe Domain Sequences for d6at6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6at6b2 b.1.1.2 (B:120-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra
Timeline for d6at6b2: