SCOPe 2.08: Domain d6at6b2: 6at6 B:120-246

Lineage for d6at6b2 (6at6 B:120-246)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)

8. Domain d6at6b2: 6at6 B:120-246 [349509]
   Other proteins in same PDB: d6at6a1, d6at6a2, d6at6b1
   automated match to d3of6b2

Details for d6at6b2

PDB Entry: 6at6, 1.42 Å

PDB Description: crystal structure of the kfj5 tcr

PDB Compounds: (B:) T-cell receptor beta variable 28, Human nkt tcr beta chain chimera

SCOPe Domain Sequences for d6at6b2:

Sequence; same for both SEQRES and ATOM records:

>d6at6b2 b.1.1.2 (B:120-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

Timeline for d6at6b2:

• d6at6b2 first appeared in SCOPe 2.07