SCOPe 2.08: Domain d6b73d1: 6b73 D:4-123

Lineage for d6b73d1 (6b73 D:4-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d6b73d1: 6b73 D:4-123 [349487]
   Other proteins in same PDB: d6b73c2, d6b73d2
   automated match to d4w81a_
   complexed with clr, cvv, ola

Details for d6b73d1

PDB Entry: 6b73, 3.1 Å

PDB Description: crystal structure of a nanobody-stabilized active state of the kappa- opioid receptor

PDB Compounds: (D:) Nanobody

SCOPe Domain Sequences for d6b73d1:

Sequence, based on SEQRES records:

>d6b73d1 b.1.1.1 (D:4-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyads
vadrfttsrdvanntlylqmnslkhedtavyycaarapvgqssspydydywgqgtqvtvs

Sequence, based on observed residues (ATOM records):

>d6b73d1 b.1.1.1 (D:4-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyads
vadrfttsrdvanntlylqmnslkhedtavyycaarapvspydydywgqgtqvtvs

Timeline for d6b73d1:

• d6b73d1 first appeared in SCOPe 2.07, called d6b73d_