Lineage for d6b73d_ (6b73 D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (170 PDB entries)
  8. 3049425Domain d6b73d_: 6b73 D: [349487]
    Other proteins in same PDB: d6b73c2
    automated match to d4w81a_
    complexed with clr, cvv, ola

Details for d6b73d_

PDB Entry: 6b73 (more details), 3.1 Å

PDB Description: crystal structure of a nanobody-stabilized active state of the kappa- opioid receptor
PDB Compounds: (D:) Nanobody

SCOPe Domain Sequences for d6b73d_:

Sequence, based on SEQRES records: (download)

>d6b73d_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyads
vadrfttsrdvanntlylqmnslkhedtavyycaarapvgqssspydydywgqgtqvtvs
shhhhh

Sequence, based on observed residues (ATOM records): (download)

>d6b73d_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvrpggslrlscvdsertsypmgwfrrapgkerefvasitwsgidptyads
vadrfttsrdvanntlylqmnslkhedtavyycaarapvspydydywgqgtqvtvsshhh
hh

SCOPe Domain Coordinates for d6b73d_:

Click to download the PDB-style file with coordinates for d6b73d_.
(The format of our PDB-style files is described here.)

Timeline for d6b73d_:

  • d6b73d_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-07