Lineage for d6b41a1 (6b41 A:2-230)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2568038Fold d.389: Menin N-terminal domain-like [310556] (1 superfamily)
    Some structural similarity to cysteine proteinases (d.3.1.4) noted in PubMed 22327296
  4. 2568039Superfamily d.389.1: Menin N-terminal domain-like [310582] (1 family) (S)
    Pfam PF05053
  5. 2568040Family d.389.1.1: Menin N-terminal domain-like [310623] (1 protein)
  6. 2568041Protein Menin N-terminal domain [310724] (2 species)
  7. 2568042Species Human (Homo sapiens) [TaxId:9606] [310972] (27 PDB entries)
  8. 3049422Domain d6b41a1: 6b41 A:2-230 [349484]
    Other proteins in same PDB: d6b41a2
    automated match to d3u85a1
    complexed with 7pr, cjv

Details for d6b41a1

PDB Entry: 6b41 (more details), 2.61 Å

PDB Description: menin bound to m-525
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d6b41a1:

Sequence, based on SEQRES records: (download)

>d6b41a1 d.389.1.1 (A:2-230) Menin N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpel
tfqpspapdppggltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkv
sdviwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedh
awvvfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrc

Sequence, based on observed residues (ATOM records): (download)

>d6b41a1 d.389.1.1 (A:2-230) Menin N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrviptnvpel
tfqpspapdgltyfpvadlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdv
iwnslsrsyfkdrahiqslfsfitgtkldssgvafavvgacqalglrdvhlalsedhawv
vfgpngeqtaevtwhgkgnedrrgqtvnagvaerswlylkgsymrc

SCOPe Domain Coordinates for d6b41a1:

Click to download the PDB-style file with coordinates for d6b41a1.
(The format of our PDB-style files is described here.)

Timeline for d6b41a1:

  • d6b41a1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07

View in 3D
Domains from same chain:
(mouse over for more information)
d6b41a2