Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
Protein automated matches [191218] (6 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [349397] (2 PDB entries) |
Domain d6b5ed_: 6b5e D: [349478] automated match to d4ho4a_ complexed with cl, dau, edo, mg, na, tyd |
PDB Entry: 6b5e (more details), 1.85 Å
SCOPe Domain Sequences for d6b5ed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b5ed_ c.68.1.6 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mrgiilaggsgtrlypitmgiskqllpvydkpmiyyplttlmmagirdiqlittphdapg fhrllgdgahlgvnisyatqdqpdglaqafviganhigadsvalvlgdnifygpglgtsl krfqsisggaifaywvanpsaygvvefgaegmalsleekpvtpksnyavpglyfydndvi eiarglkksargeyeitevnqvylnqgrlavevlargtawldtgtfdslldaadfvrtle rrqglkvsipeevawrmgwiddeqlvqraralvksgygnyllelle
Timeline for d6b5ed_: